PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1239s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 382aa    MW: 41672 Da    PI: 6.1232
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1239s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1018e-32247302156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH++Fv+a++qLGG+++AtPk+i++lm v+gLt+++vkSHLQkYRl+
  Kalax.1239s0001.1.p 247 KQRRCWSPELHKAFVSALQQLGGPKVATPKQIRDLMRVDGLTNDEVKSHLQKYRLH 302
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.996244304IPR017930Myb domain
SuperFamilySSF466895.73E-17245305IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-28246305IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-25247302IPR006447Myb domain, plants
PfamPF002494.6E-7249300IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MEGCEGVVAM SLGFGSTGFV PRTIAEFVAR ISSIGNVQKR LSELDEYVGC LEEEMRKIHA  60
FKRELPLCML LLSDAIGYLK EQSRRWCKWG SGGGGSEVVE KVEIDLMKES VDESQVETAA  120
GRNEDCGDKK TWMSSFQLWS CDLNAVSGCS SKLNQKVEEA RKCKLGDLFP AAESKGDNVW  180
ASMKVGADCP VTLEEKKAAQ PIVPELSLVT PGVCNLGRKL NVNGVAHRGS SSIQLSSTSV  240
HQQSCRKQRR CWSPELHKAF VSALQQLGGP KVATPKQIRD LMRVDGLTND EVKSHLQKYR  300
LHIRRVPDPN KQTDSSASQS LGLPWNKDLI QSGESSKHSK DSESGSPPGP LELDIHPPGT  360
STSGGGDNME PDEDENYCSY D*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-54G2-like family protein